4.18 Rating by CuteStat

sanieattivi.it is 8 years 1 month old. It is a domain having it extension. It has a global traffic rank of #6395134 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, sanieattivi.it is SAFE to browse.

PageSpeed Score
67
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 132
Daily Pageviews: 264

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 1,750
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 46,100
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,395,134
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

51.77.90.225

Hosted Country:

France FR

Location Latitude:

48.8582

Location Longitude:

2.3387
Home - Sanieattivi.it

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 39
H3 Headings: Not Applicable H4 Headings: 12
H5 Headings: 5 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 82
Google Adsense: pub-4746971679749461 Google Analytics: UA-30545690-15

Websites Hosted on Same IP (i.e. 51.77.90.225)


403 Forbidden

- wowriter.com
Not Applicable $ 8.95


Esoteropedia

- esoteropedia.org
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=60
Vary: Accept-Encoding,User-Agent
Strict-Transport-Security: max-age=15552000
x-is-mobile: false
x-request-time: 0.008
x-creativepro-whoserved: fpm
Date: Wed, 11 Dec 2019 12:16:23 GMT
X-Page-Speed: 1.13.35.1-0
Content-Encoding: gzip
Cache-Control: s-maxage=10

Domain Information

Domain Registrar: Nimzo 13, LLC
Registration Date: Apr 9, 2016, 8:33 PM 8 years 1 month 5 days ago
Expiration Date: Apr 9, 2020, 12:00 AM 4 years 1 month 1 day ago
Domain Status:
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
dns200.anycast.me 46.105.206.200 France France
ns200.anycast.me 46.105.207.200 France France

DNS Record Analysis

Host Type TTL Extra
sanieattivi.it A 3599 IP: 51.77.90.225
sanieattivi.it NS 3600 Target: dns200.anycast.me
sanieattivi.it NS 3600 Target: ns200.anycast.me
sanieattivi.it SOA 300 MNAME: dns200.anycast.me
RNAME: tech.ovh.net
Serial: 2019012400
Refresh: 86400
Retry: 3600
Expire: 3600000
Minimum TTL: 300
sanieattivi.it MX 3600 Priority: 1
Target: redirect.ovh.net
sanieattivi.it TXT 3600 TXT: 1|www.sanieattivi.it

Similarly Ranked Websites

hattrick.de | Der Onlineshop für Sportartikel, Fußball Bekleidung, Fa

- hattrick.de

hattrick.de ★★★★★ Deutschlands Sport Shop ✔ Günstige Preise ✔ Schnelle Lieferung ✔ Große Auswahl ✔ Fußballschuhe und Sportbekleidung ✔ Alles für die hattrick Freunde ✔

6,395,139 $ 240.00

SMS Marketing | Group Text Reminders

- rockstarsmsmarketing.com

Statistics prove that nine out of every ten text messages are opened within one minute after they are received. This proves that text messages are rapidly

6,395,144 $ 8.95

ST Philips Hastings - Free Mp3 Downloads Songs Music

- stphilipshastings.com

ST Philips Hastings ✅ Free Mp3 music download ✅ Milions music audio mp3 songs and Audiobooks ✅ Price only $0 ✅ Listen music songs online ✅ Download Newest songs for FREE

6,395,151 $ 240.00

Adana Evden Eve Nakliyat ve Taşımacılık - 0322 270 00 70

- adanaevdenevenakliyatfirmalari.com

Adana evden eve nakliyat ve Adana evden eve taşımacılık firması olarak siz değerli müşterilerimize hizmet vermekten gurur duyarız. Sayısız referanslarımıza site üzerinden ulaşa bilirsiniz, dilerseniz iletişim bölümünden iletişime geçebilirsiniz.

6,395,157 $ 240.00

Gereja Gembala Yang Baik | Surabaya

- gerejagembalayangbaik.org

Website resmi Gereja Gembala Yang Baik (GYB). Tersedia jadwal misa dan berbagai hal lainnya. GYB berlokasi di Surabaya, Indonesia

6,395,158 $ 8.95

Full WHOIS Lookup

*********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://web-whois.nic.it *
* Privacy Information: http://web-whois.nic.it/privacy *
*********************************************************************

Domain: sanieattivi.it
Status: clientDeleteProhibited
Signed: no
Created: 2016-04-09 20:33:20
Last Update: 2019-04-25 00:52:55
Expire Date: 2020-04-09

Registrant
Organization: hidden

Admin Contact
Name: hidden
Organization: hidden

Technical Contacts
Name: hidden
Organization: hidden

Registrar
Organization: OVH
Name: OVH-REG
Web: http://www.ovh.com/welcome
DNSSEC: no


Nameservers
dns200.anycast.me
ns200.anycast.me